Novus Biologicals
Manufacturer Code:NBP233638
Catalog # NBP233638
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 47 kDa autosomal chronic granulomatous disease protein; 47 kDa neutrophil oxidase factor; 47 kDa neutrophil oxidase factor FLJ79451 NADPH oxidase organizer 2 NCF-1 NCF1A neutrophil cytosol factor 147 kDa autosomal chronic granulomatous disease protein neutrophil cytosolic factor 1 neutrophil cytosolic factor 1 (47kD chronic granulomatous disease autosomal1) neutrophil cytosolic factor 1 (chronic granulomatous disease autosomal 1) Neutrophil NADPH oxidase factor 1 Nox organizer 2 NOXO2NCF-47K Nox-organizing protein 2 p47phox SH3 and PX domain-containing protein 1A SH3PXD1Ap47-phox; NADPH oxidase organizer 2; NCF-1; NCF-47K; Neutrophil cytosol factor 1; neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1); Neutrophil NADPH oxidase factor 1; Nox organizer 2; Nox-organizing protein 2; p47-phox; SH3 and PX domain-containing protein 1A
Gene Aliases: NCF1; NCF1A; NOXO2; p47phox; SH3PXD1A
UniProt ID: (Human) P14598
Entrez Gene ID: (Human) 653361
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.