Novus Biologicals
Manufacturer Code:NBP258516
Catalog # NBP258516
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B-box protein; Cell migration-inducing gene 19 protein; Cell migration-inducing gene 19 protein FLJ98272 KIAA0049CA125 M17S2FLJ553591A1-3B Membrane component chromosome 17 surface marker 21A13B membrane component chromosome 17 surface marker 2 (ovarian carcinoma antigenCA125) migration-inducing protein 19 neighbor of BRCA1 gene 1 Neighbor of BRCA1 gene 1 protein next to BRCA1 gene 1 protein Protein 1A1-3B; Membrane component chromosome 17 surface marker 2; membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); migration-inducing protein 19; neighbor of BRCA1 gene 1; Neighbor of BRCA1 gene 1 protein; Next to BRCA1 gene 1 protein; Protein 1A1-3B
Gene Aliases: 1A1-3B; 1A13B; IAI3B; KIAA0049; M17S2; MIG19; NBR1
UniProt ID: (Human) Q14596
Entrez Gene ID: (Human) 4077
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.