Novus Biologicals
Manufacturer Code:NBP15952620UL
Catalog # NBP15952620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NAT2 (N-acetyltransferase 2 (arylamine N-acetyltransferase)) The peptide sequence was selected from the middle region of NAT2)(50ug). Peptide sequence TYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AAC2N-acetyltransferase type 2 Arylamide acetylase 2 arylamine N-acetyltransferase 2 EC 2.3.1.5 N-acetyltransferase 2 (arylamine N-acetyltransferase) NAT-2 PNAT Polymorphic arylamine N-acetyltransferase; Arylamide acetylase 2; Arylamine N-acetyltransferase 2; N-acetyltransferase 2 (arylamine N-acetyltransferase); N-acetyltransferase type 2; NAT-2; PNAT; Polymorphic arylamine N-acetyltransferase
Gene Aliases: AAC2; NAT-2; NAT2; PNAT
UniProt ID: (Human) P11245
Entrez Gene ID: (Human) 10
Molecular Function:
acetyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.