Novus Biologicals
Manufacturer Code:NBP192168
Catalog # NBP192168
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.3.1.- FLJ13848 N(alpha)-acetyltransferase 40 NatD catalytic subunit homolog (S. cerevisiae) N-acetyltransferase 11 N-acetyltransferase 11 (GCN5-related putative) N-alpha-acetyltransferase 40 NatD catalytic subunit NAT11 PATT1; N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog; N-acetyltransferase 11; N-acetyltransferase 11 (GCN5-related, putative); N-alpha acetyl transferase 40; N-alpha-acetyltransferase 40; N-alpha-acetyltransferase 40, NatD catalytic subunit; N-alpha-acetyltransferase D; NatD; natD catalytic subunit; Protein acetyltransferase 1
Gene Aliases: NAA40; NAT11; PATT1
UniProt ID: (Human) Q86UY6
Entrez Gene ID: (Human) 79829
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.