Novus Biologicals
Manufacturer Code:NBP257390
Catalog # NBP257390
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 18S rRNA cytosine acetyltransferase; ALP DKFZp434C116 EC 2.3.1.- FLJ10774 FLJ12179 FLJ23850 hALP KIAA1709 N-acetyltransferase 10 N-acetyltransferase 10 (GCN5-related) N-acetyltransferase-like protein NET43; hALP; N-acetyltransferase 10; N-acetyltransferase 10 (GCN5-related); N-acetyltransferase-like protein; RNA cytidine acetyltransferase
Gene Aliases: ALP; KIAA1709; NAT10; NET43
UniProt ID: (Human) Q9H0A0
Entrez Gene ID: (Human) 55226
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.