Novus Biologicals
Manufacturer Code:NBP15291420UL
Catalog # NBP15291420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NASP(nuclear autoantigenic sperm protein (histone-binding)) The peptide sequence was selected from the middle region of NASP. Peptide sequence KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp547F162 FLB7527 FLJ31599 FLJ35510 histone H1-binding protein MGC19722 MGC20372 MGC2297 nuclear autoantigenic sperm protein nuclear autoantigenic sperm protein (histone-binding) PRO1999; histone H1-binding protein; NASP; NASP histone chaperone; Nuclear autoantigenic sperm protein; nuclear autoantigenic sperm protein (histone-binding)
Gene Aliases: FLB7527; HMDRA1; NASP; PRO1999
UniProt ID: (Human) P49321
Entrez Gene ID: (Human) 4678
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.