Novus Biologicals
Manufacturer Code:NBP213640
Catalog # NBP213640
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKE HDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AsnRS; ASNRS asparagine tRNA ligase 1 cytoplasmic Asparagine--tRNA ligase asparaginyl-tRNA synthetase asparaginyl-tRNA synthetase cytoplasmic EC 6.1.1.22 NARS1; asparagine tRNA ligase 1, cytoplasmic; Asparagine--tRNA ligase, cytoplasmic; Asparaginyl-tRNA synthetase; Asparaginyl-tRNA synthetase 1; asparaginyl-tRNA synthetase, cytoplasmic
Gene Aliases: ASNRS; NARS; NARS1; NRS
UniProt ID: (Human) O43776
Entrez Gene ID: (Human) 4677
Molecular Function:
RNA binding protein
aminoacyl-tRNA synthetase
ligase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.