Novus Biologicals
Manufacturer Code:NBP192167
Catalog # NBP192167
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LVEEIKGEILLKLGRLKEASEVFKNLIDRNAENWCYYEGLEKALQISTLEERLQIYEEISKQHPKAITPRRLPLTLVPGERF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ22054 MGC40612 N(alpha)-acetyltransferase 16 NatA auxiliary subunit N-alpha-acetyltransferase 16 NatA auxiliary subunit NARG1L NARG1-like protein NAT2 NMDA receptor regulated 1-like NMDA receptor-regulated 1-like protein PRO2435; N-alpha-acetyltransferase 16, NatA auxiliary subunit; NARG1-like protein; NMDA receptor-regulated 1-like protein
Gene Aliases: NAA16; NARG1L; NAT2
UniProt ID: (Human) Q6N069
Entrez Gene ID: (Human) 79612
Molecular Function: acetyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.