Novus Biologicals
Manufacturer Code:NBP19843320UL
Catalog # NBP19843320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Peptide sequence (RLIAGPDKKLLEMGLRRAQGPDGGFTASIYSYLGGFDSSSNTLAGQLRGV) from N-terminal region of mouse Naprt1 (NP_766195). |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.4.2.11 FHA-HIT-interacting protein FHIP NAPRTase nicotinate phosphoribosyltransferase nicotinate phosphoribosyltransferase domain containing 1 Nicotinate phosphoribosyltransferase domain-containing protein 1 nicotinic acid phosphoribosyltransferase PP3856; FHA-HIT-interacting protein; NAPRTase; Nicotinate phosphoribosyltransferase; nicotinate phosphoribosyltransferase domain containing 1; Nicotinate phosphoribosyltransferase domain-containing protein 1; nicotinic acid phosphoribosyltransferase
Gene Aliases: FHIP; NAPRT; NAPRT1; PP3856
UniProt ID: (Human) Q6XQN6
Entrez Gene ID: (Human) 93100
Molecular Function: glycosyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.