Novus Biologicals
Manufacturer Code:NBP17995520UL
Catalog # NBP17995520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human NAPA. Peptide sequence MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAAN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha soluble NSF attachment protein; alpha-SNAP; alpha-SNAP alpha-soluble NSF attachment protein N-ethylmaleimide-sensitive factor attachment protein alpha N-ethylmaleimide-sensitive factor attachment protein alpha S SNAPA SNAP-alpha; Alpha-soluble NSF attachment protein; N-ethylmaleimide-sensitive factor attachment protein alpha; N-ethylmaleimide-sensitive factor attachment protein, alpha; SNAP-alpha
Gene Aliases: NAPA; SNAPA
UniProt ID: (Human) P54920
Entrez Gene ID: (Human) 8775
Molecular Function:
membrane traffic protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.