Novus Biologicals
Manufacturer Code:NBP187088
Catalog # NBP187088
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.5.1.56 EC 2.5.1.57 N-acetylneuraminate synthase N-acetylneuraminate-9-phosphate synthase N-acetylneuraminic acid phosphate synthase N-acetylneuraminic acid synthasesialic acid phosphate synthase SASsialic acid synthase; epididymis secretory protein Li 100; N-acetylneuraminate synthase; N-acetylneuraminate-9-phosphate synthase; N-acetylneuraminic acid phosphate synthase; N-acetylneuraminic acid synthase; sialic acid phosphate synthase; Sialic acid synthase
Gene Aliases: HEL-S-100; NANS; SAS; SEMDG
UniProt ID: (Human) Q9NR45
Entrez Gene ID: (Human) 54187
Molecular Function:
acetyltransferase
lyase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.