Novus Biologicals
Manufacturer Code:NBP198562
Catalog # NBP198562
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is NADK - C-terminal region. Peptide sequence ARNTAWVSFDGRKRQEIRHGDSISITTSCYPLPSICVRDPVSDWFESLAQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dJ283E3.1 DKFZp686L22239 EC 2.7.1 EC 2.7.1.23 FLJ13052 FLJ37724 FLJ54695 FLJ77769 FLJ78247 FLJ78307 MGC1900 NAD kinase Poly(P)/ATP NAD kinase; NAD kinase; Poly(P)/ATP NAD kinase
Gene Aliases: dJ283E3.1; NADK
UniProt ID: (Human) O95544
Entrez Gene ID: (Human) 65220
Molecular Function:
kinase
nucleotide kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.