Novus Biologicals
Manufacturer Code:NBP188391
Catalog # NBP188391
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C12orf30DKFZp667K2112 chromosome 12 open reading frame 30 FLJ13089 MDM20mitochondrial distribution and morphology 20 Mitochondrial distribution and morphology protein 20 N(alpha)-acetyltransferase 25 NatB auxiliary subunit N-alpha-acetyltransferase 25 NatB auxiliary subunit NAP1 NatB complex subunit MDM20 N-terminal acetyltransferase B complex subunit MDM20 N-terminal acetyltransferase B complex subunit NAA25 p120; mitochondrial distribution and morphology 20; Mitochondrial distribution and morphology protein 20; N-alpha-acetyltransferase 25, NatB auxiliary subunit; N-terminal acetyltransferase B complex subunit MDM20; N-terminal acetyltransferase B complex subunit NAA25; NatB complex subunit MDM20; p120
Gene Aliases: C12orf30; MDM20; NAA25; NAP1
UniProt ID: (Human) Q14CX7
Entrez Gene ID: (Human) 80018
Molecular Function: acetyltransferase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.