Novus Biologicals
Manufacturer Code:NBP19132720UL
Catalog # NBP19132720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Rat |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The specific Immunogen is proprietary information. Peptide sequence SAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDLA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: =N-terminal acetyltransferase complex ARD1 subunit homolog B; ARD1 homolog B; ARD1 homolog B ARD1B ARD2 hARD2 human arrest defective 2 MGC10646 N(alpha)-acetyltransferase 11 NatA catalytic subunit NatA catalytic subunit N-terminal acetyltransferase complex ARD1 subunit homolog B; hARD2; human arrest defective 2; N-alpha-acetyltransferase 11; N-alpha-acetyltransferase 11, NatA catalytic subunit; N-terminal acetyltransferase complex ARD1 subunit homolog B; NatA catalytic subunit Naa11
Gene Aliases: ARD1B; ARD2; hARD2; NAA11
UniProt ID: (Human) Q9BSU3
Entrez Gene ID: (Human) 84779
Molecular Function:
acetyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.