Novus Biologicals
Manufacturer Code:NBP157762
Catalog # NBP157762
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RP11-298P3.3 (NEDD4 binding protein 2-like 2) The peptide sequence was selected from the N terminal of RP11-298P3.3)(50ug). Peptide sequence EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CG005FLJ41089 CG016 FLJ36195 NEDD4 binding protein 2-like 2 NEDD4-binding protein 2-like 2 PFAAP5FLJ43077 Phosphonoformate immuno-associated protein 592M18.392M18.3 (novel protein) protein from BCRA2 region; NEDD4 binding protein 2-like 2; NEDD4-binding protein 2-like 2; Phosphonoformate immuno-associated protein 5; protein from BRCA2 region
Gene Aliases: 92M18.3; CG005; CG016; N4BP2L2; PFAAP5
UniProt ID: (Human) Q92802
Entrez Gene ID: (Human) 10443
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.