Novus Biologicals
Manufacturer Code:NBP153083
Catalog # NBP153083
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MYOZ1(myozenin 1) The peptide sequence was selected from the middle region of MYOZ1 (NP_067068). Peptide sequence TVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Calsarcin-2; calsarcin-2 CS-2 FATZ Filamin- actinin- and telethonin-binding protein MYOZ myozenin myozenin 1 myozenin-1 Protein FATZ; Filamin-, actinin- and telethonin-binding protein; MYOZ1; Myozenin-1; Protein FATZ
Gene Aliases: CS-2; FATZ; MYOZ; MYOZ1
UniProt ID: (Human) Q9NP98
Entrez Gene ID: (Human) 58529
Molecular Function: structural protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.