Novus Biologicals
Manufacturer Code:NBP189769
Catalog # NBP189769
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:NLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTLAFQELKSELTEVPASRIL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: GLC1Amyocilin GPOA JOAG JOAG1 myocilin trabecular meshwork inducible glucocorticoid response TIGRmutated trabecular meshwork-induced glucocorticoid response protein Trabecular meshwork-induced glucocorticoid response protein; juvenile-onset open-angle glaucoma 1; mutated trabecular meshwork-induced glucocorticoid response protein; Myocilin; Myocilin 20 kDa N-terminal fragment; Myocilin 35 kDa N-terminal fragment; Myocilin 55 kDa subunit; myocilin trabecular meshwork inducible glucocorticoid response; myocilin trabecular meshwork inducible glucocorticoid response protein; Myocilin, C-terminal fragment; Myocilin, N-terminal fragment; myocilin, trabecular meshwork inducible glucocorticoid response; trabecular meshwork inducible glucocorticoid response protein; Trabecular meshwork-induced glucocorticoid response protein
Gene Aliases: GLC1A; GPOA; JOAG; JOAG1; MYOC; TIGR
UniProt ID: (Human) Q99972
Entrez Gene ID: (Human) 4653
Molecular Function: receptor structural protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.