Novus Biologicals
Manufacturer Code:NBP213632
Catalog # NBP213632
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVK NPVGEDQVNLTVKVIDVPDA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C-protein, cardiac muscle isoform; Cardiac MyBP-C; Cardiac MyBP-C CMH4 C-protein cardiac muscle isoform DKFZp779E1762 FHC MYBP-C myosin binding protein C cardiac myosin-binding protein C cardiac myosin-binding protein C cardiac-type; Myosin-binding protein C, cardiac-type; truncated cardiac myosin-binding protein C
Gene Aliases: CMD1MM; CMH4; FHC; LVNC10; MYBP-C; MYBPC3
UniProt ID: (Human) Q14896
Entrez Gene ID: (Human) 4607
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.