Novus Biologicals
Manufacturer Code:NBP238653
Catalog # NBP238653
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: STVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATFB4 cardiac voltage-gated potassium channel accessory subunit 2 human minK-related peptide 1 potassium channel subunit MiRP110Minimum potassium ion channel-related peptide 1 LQT5 LQT6 MGC138292 MinK-related peptide 1 minK-related peptide-1 MIRP1 Potassium channel subunit beta MiRP1 potassium channel subunit MiRP1 potassium voltage-gated channel subfamily E member 2 potassium voltage-gated channel Isk-related family member 2 voltage-gated K+ channel subunit MIRP1; cardiac voltage-gated potassium channel accessory subunit 2; Minimum potassium ion channel-related peptide 1; MinK-related peptide 1; minK-related peptide-1; Potassium channel subunit beta MiRP1; potassium channel subunit, MiRP1; potassium channel, voltage gated subfamily E regulatory beta subunit 2; Potassium voltage-gated channel subfamily E member 2; potassium voltage-gated channel, Isk-related family, member 2; voltage-gated K+ channel subunit MIRP1
Gene Aliases: ATFB4; KCNE2; LQT5; LQT6; MIRP1
UniProt ID: (Human) Q9Y6J6
Entrez Gene ID: (Human) 9992
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.