Novus Biologicals
Manufacturer Code:NBP234013
Catalog # NBP234013
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LLNSELADALGGLLNRCTAKRINPSETYPAFCTTCFPSEPGLVGPSVRAQAEDYALVSAVATLPKQVADHYDNFRIYKALEAVSSCVRQTNG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 6.1.1 EC 6.1.1.10 methionine tRNA ligase 2 mitochondrial methionine-tRNA ligase Methionine--tRNA ligase 2 methionine-tRNA synthetase 2 (mitochondrial) methionine-tRNA synthetase 2 mitochondrial methionyl-tRNA synthetase 2 mitochondrial methionyl-tRNA synthetase mitochondrial MetRS Mitochondrial methionine--tRNA ligase mitochondrial methionyl-tRNA synthetase mtMetRS; methionine tRNA ligase 2, mitochondrial; methionine--tRNA ligase 2; Methionine--tRNA ligase, mitochondrial; methionine-tRNA synthetase 2, mitochondrial; Methionyl-tRNA synthetase 2; Mitochondrial methionyl-tRNA synthetase; MtMetRS
Gene Aliases: COXPD25; MARS2; MetRS; mtMetRS
UniProt ID: (Human) Q96GW9
Entrez Gene ID: (Human) 92935
Molecular Function:
aminoacyl-tRNA synthetase
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.