Novus Biologicals
Manufacturer Code:NBP15308820UL
Catalog # NBP15308820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to METAP1(methionyl aminopeptidase 1) The peptide sequence was selected from the N terminal of METAP1. Peptide sequence GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZp781C0419 EC 3.4.11.18 KIAA0094MAP 1 MAP1A MetAP 1 MetAP1A methionine aminopeptidase 1 methionyl aminopeptidase 1 Peptidase M 1; MAP 1; metAP 1; Methionine aminopeptidase 1; Peptidase M 1
Gene Aliases: KIAA0094; MAP1A; METAP1; MetAP1A
UniProt ID: (Human) P53582
Entrez Gene ID: (Human) 23173
Molecular Function: hydrolase metalloprotease nucleic acid binding protease transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.