Novus Biologicals
Manufacturer Code:NBP232497
Catalog # NBP232497
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPAFLHSPSCPAIISSSEKLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.11 EC 2.7.11.18 KMLC MLCK2MLCK myosin light chain kinase 2 myosin light chain kinase 2 skeletal/cardiac muscle skeletal muscle skMLCK; MLCK2; myosin light chain kinase 2, skeletal muscle; Myosin light chain kinase 2, skeletal/cardiac muscle
Gene Aliases: KMLC; MLCK; MLCK2; MYLK2; skMLCK
UniProt ID: (Human) Q9H1R3
Entrez Gene ID: (Human) 85366
Molecular Function:
non-receptor serine/threonine protein kinase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.