Novus Biologicals
Manufacturer Code:NBP160099
Catalog # NBP160099
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MTUS1(mitochondrial tumor suppressor 1) The peptide sequence was selected from the middle region of MTUS1. Peptide sequence KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Angiotensin-II type 2 receptor-interacting protein; Angiotensin-II type 2 receptor-interacting protein AT2 receptor-binding protein AT2R binding protein ATBPATIP1 ATIP DKFZp586D1519 erythroid differentiation-related FLJ14295 GK1 KIAA1288DKFZp686F20243 microtubule associated tumor suppressor 1 microtubule-associated tumor suppressor 1 Mitochondrial tumor suppressor 1 mitochondrial tumor suppressor gene 1 MP44 MTSG1AT2 receptor-interacting protein transcription factor MTSG1; AT2 receptor-binding protein; AT2 receptor-interacting protein; AT2R binding protein; erythroid differentiation-related; Microtubule-associated tumor suppressor 1; Mitochondrial tumor suppressor 1; mitochondrial tumor suppressor gene 1; transcription factor MTSG1
Gene Aliases: ATBP; ATIP; GK1; ICIS; KIAA1288; MP44; MTSG1; MTUS1
UniProt ID: (Human) Q9ULD2
Entrez Gene ID: (Human) 57509
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.