Novus Biologicals
Manufacturer Code:NBP162489
Catalog # NBP162489
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human MTTP (NP_000244). Peptide sequence within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 88kD) 88kDa) ABL MGC149819 microsomal triglyceride transfer protein microsomal triglyceride transfer protein large subunit MTPMGC149820; microsomal triglyceride transfer protein (large polypeptide, 88kDa); Microsomal triglyceride transfer protein large subunit
Gene Aliases: ABL; MTP; MTTP
UniProt ID: (Human) P55157
Entrez Gene ID: (Human) 4547
Molecular Function: apolipoprotein transfer/carrier protein transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.