Novus Biologicals
Manufacturer Code:NBP15774920UL
Catalog # NBP15774920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MTRR (5-methyltetrahydrofolate-homocysteine methyltransferase reductase) The peptide sequence was selected from the N terminal of MTRR)(50ug). Peptide sequence YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: [methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing); [methionine synthase]-cobalamin methyltransferase (cob(II)alamin reducing) 5-methyltetrahydrofolate-homocysteine methyltransferase reductase cblE EC 1.16.1.8 methionine synthase reductase methionine synthase reductase mitochondrial MGC129643 MSR; AqCbl reductase; Aquacobalamin reductase; Methionine synthase reductase; methionine synthase reductase, mitochondrial; MSR
Gene Aliases: cblE; MSR; MTRR
UniProt ID: (Human) Q9UBK8
Entrez Gene ID: (Human) 4552
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.