Novus Biologicals
Manufacturer Code:NBP154767
Catalog # NBP154767
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MTO1(mitochondrial translation optimization 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of MTO1 (NP_001116698). Peptide sequence STVYAESVILTTGTFLRGMIVIGLETHPAGRLGDQPSIGLAQTLEKLGFV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.1.1.40 EC 6.3.5 homolog of yeast Mto1 mitochondrial MTO1-3 mitochondrial translation optimization 1 homolog (S. cerevisiae) protein MTO1 homolog mitochondrial; homolog of yeast Mto1; mitochondrial MTO1-3; mitochondrial translation optimization 1 homolog; Protein MTO1 homolog, mitochondrial
Gene Aliases: CGI-02; COXPD10; MTO1
UniProt ID: (Human) Q9Y2Z2
Entrez Gene ID: (Human) 25821
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.