Novus Biologicals
Manufacturer Code:NBP154988
Catalog # NBP154988
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MTMR12(myotubularin related protein 12) The peptide sequence was selected from the middle region of MTMR12. Peptide sequence RNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-PAP; 3-PAP3PAP 3-phosphatase adapter subunit KIAA1682FLJ20476 myotubularin related protein 12 myotubularin-related protein 123-phosphatase adapter protein Phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit phosphatidylinositol-3-phosphate associated protein PIP3AP; 3-phosphatase adapter protein; 3-phosphatase adapter subunit; Inactive phosphatidylinositol 3-phosphatase 12; Myotubularin-related protein 12; Phosphatidylinositol 3 phosphate 3-phosphatase adapter subunit; phosphatidylinositol-3 phosphate 3-phosphatase adapter subunit; phosphatidylinositol-3 phosphate 3-phosphatase adaptor subunit; phosphatidylinositol-3-phosphate associated protein
Gene Aliases: 3-PAP; KIAA1682; MTMR12; PIP3AP
UniProt ID: (Human) Q9C0I1
Entrez Gene ID: (Human) 54545
Molecular Function:
hydrolase
phosphatase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.