Novus Biologicals
Manufacturer Code:NBP156698
Catalog # NBP156698
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MTHFS(510-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase)) The peptide sequence was selected from the middle region of MTHFS. Peptide sequence TSWNIPQPGEGDVREEALSTGGLDLIFMPGL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 5,10-methenyl-tetrahydrofolate synthetase; 5-formyltetrahydrofolate cyclo-ligase; 510-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolatecyclo-ligase) 5-formyltetrahydrofolate cyclo-ligase EC 6.3.3.2510-methenyl-tetrahydrofolate synthetase FLJ30410 HsT19268 Methenyl-THF synthetase; methenyl-THF synthetase; MTHFS
Gene Aliases: HsT19268; MTHFS
UniProt ID: (Human) P49914
Entrez Gene ID: (Human) 10588
Molecular Function:
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.