Novus Biologicals
Manufacturer Code:NBP15646820UL
Catalog # NBP15646820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MTHFD2L(methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like) The peptide sequence was selected from the middle region of MTHFD2L. Peptide sequence TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ13105 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2-like MGC45532 MGC72244 NADP-dependent methylenetetrahydrofolate dehydrogenase 2-like protein probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2; Methenyltetrahydrofolate cyclohydrolase; MTHFD2-like; NAD-dependent methylenetetrahydrofolate dehydrogenase; NADP-dependent methylenetetrahydrofolate dehydrogenase 2-like protein; Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2; tetrahydrofolate dehydrogenase/cyclohydrolase
Gene Aliases: MTHFD2L
UniProt ID: (Human) Q9H903
Entrez Gene ID: (Human) 441024
Molecular Function:
dehydrogenase
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.