Novus Biologicals
Manufacturer Code:NBP15961420UL
Catalog # NBP15961420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MRS2L The peptide sequence was selected from the middle region of MRS2L. Peptide sequence LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: HPT MGC78523 mitochondrial MRS2 magnesium homeostasis factor homolog (S. cerevisiae) MRS2-like protein MRS2-like magnesium homeostasis factor MRS2-like magnesium homeostasis factor (S. cerevisiae); Magnesium transporter MRS2 homolog, mitochondrial; MRS2 magnesium transporter; MRS2-like protein; MRS2-like, magnesium homeostasis factor; putative magnesium transporter
Gene Aliases: HPT; MRS2; MRS2L
UniProt ID: (Human) Q9HD23
Entrez Gene ID: (Human) 57380
Molecular Function:
cation transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.