Novus Biologicals
Manufacturer Code:NBP182729
Catalog # NBP182729
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDKGRAKGT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 28S ribosomal protein S34, mitochondrial; MGC2616 mitochondrial ribosomal protein S34 MRPS12 MRP-S1228S ribosomal protein S34 mitochondrial MRP-S34 S34mt; mitochondrial 28S ribosomal protein S34; Mitochondrial small ribosomal subunit protein mS34; MRP-S34; S34mt
Gene Aliases: MRP-S12; MRP-S34; MRPS12; MRPS34
UniProt ID: (Human) P82930
Entrez Gene ID: (Human) 65993
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.