Novus Biologicals
Manufacturer Code:NBP182805
Catalog # NBP182805
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:RRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 39S ribosomal protein L28, mitochondrial; L28mt; L28mt MAAT139S ribosomal protein L28 mitochondrial Melanoma antigen p15 melanoma-associated antigen recognised by cytotoxic T lymphocytes Melanoma-associated antigen recognized by T lymphocytes MGC8499 mitochondrial ribosomal protein L28 MRP-L28 p15; Melanoma antigen p15; melanoma-associated antigen recognised by cytotoxic T lymphocytes; melanoma-associated antigen recognized by T lymphocytes; Melanoma-associated antigen recognized by T-lymphocytes; Mitochondrial large ribosomal subunit protein bL28m; MRP-L28
Gene Aliases: MAAT1; MRPL28; p15
UniProt ID: (Human) Q13084
Entrez Gene ID: (Human) 10573
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.