Novus Biologicals
Manufacturer Code:NBP182858
Catalog # NBP182858
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:NVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFLEDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRTVPFLPLLGGC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 39S ribosomal protein L10, mitochondrial; 39S ribosomal protein L8, mitochondrial; L10mt; L10mt MGC17973 mitochondrial ribosomal protein L10 MRP-L10L8mt MRP-L839S ribosomal protein L10 mitochondrial MRPL839S ribosomal protein L8 mitochondrial RPML8L10MT; L8mt; Mitochondrial large ribosomal subunit protein uL10m
Gene Aliases: L10MT; MRP-L10; MRP-L8; MRPL10; MRPL8; RPML8
UniProt ID: (Human) Q7Z7H8
Entrez Gene ID: (Human) 124995
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.