Invitrogen
Manufacturer Code:MA516079
Catalog # PIMA516079
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Mouse |
Class | Monoclonal |
Type | Antibody |
Clone | IU5C1 |
Immunogen | A recombit peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | -20° C Avoid Freeze/Thaw Cycles |
Mouse Monoclonal Antibody
For Research Use Only
Protein Aliases: ABC29 ABCC GS-X MRP MRP1 ATP-binding cassette transporter variant ABCC1delta-ex13 ATP-binding cassette transporter variant ABCC1delta-ex13&14 ATP-binding cassette transporter variant ABCC1delta-ex25 ATP-binding cassette transporter variant ABCC1delta-ex25&26 LTC4 transporter leukotriene C(4) transporter multidrug resistance-associated protein 1; ATP-binding cassette sub-family C member 1; ATP-binding cassette transporter variant ABCC1delta-ex13; ATP-binding cassette transporter variant ABCC1delta-ex13&14; ATP-binding cassette transporter variant ABCC1delta-ex25; ATP-binding cassette transporter variant ABCC1delta-ex25&26; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1a; ATP-binding cassette, sub-family C (CFTR/MRP), member 1b; Glutathione-S-conjugate-translocating ATPase ABCC1; Leukotriene C(4) transporter; LTC4 transporter; Multidrug resistance-associated protein 1; multiple drug resistance-associated protein
Gene Aliases: ABC29; ABCC; ABCC1; Abcc1a; Abcc1b; GS-X; Mdrap; MRP; MRP1
UniProt ID: (Human) P33527, (Mouse) O35379
Entrez Gene ID: (Human) 4363, (Mouse) 17250
Molecular Function: ATP-binding cassette (ABC) transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.