Novus Biologicals
Manufacturer Code:NBP188941
Catalog # NBP188941
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B27; B27GCCD2 C21orf61chromosome 21 open reading frame 61 FALPFGD2 Fat cell-specific low molecular weight protein Fat tissue-specific low MW protein melanocortin 2 receptor accessory protein melanocortin-2 receptor accessory protein; Fat cell-specific low molecular weight protein; Fat tissue-specific low MW protein; Melanocortin-2 receptor accessory protein
Gene Aliases: B27; C21orf61; FALP; FGD2; GCCD2; MRAP
UniProt ID: (Human) Q8TCY5
Entrez Gene ID: (Human) 56246
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.