Novus Biologicals
Manufacturer Code:NBP153081
Catalog # NBP153081
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MPP7(membrane protein palmitoylated 7 (MAGUK p55 subfamily member 7)) The peptide sequence was selected from the N terminal of MPP7. Peptide sequence MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ32798 MAGUK p55 subfamily member 7 membrane protein palmitoylated 7 (MAGUK p55 subfamily member 7); MAGUK p55 subfamily member 7; membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)
Gene Aliases: MPP7
UniProt ID: (Human) Q5T2T1
Entrez Gene ID: (Human) 143098
Molecular Function: cell junction protein kinase nucleotide kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.