Novus Biologicals
Manufacturer Code:NBP159730
Catalog # NBP159730
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MPG(N-methylpurine-DNA glycosylase) The peptide sequence was selected from the C terminal of MPG. Peptide sequence LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3' end of the Mid1 gene localized 68 kb upstream the humanzeta globin gene on16p 3-alkyladenine DNA glycosylase 3-methyladenine DNA glycosidase AAG ADPG ANPG APNG CRA36.1 CRA36.1 (3-methyl-adenine DNA glycosylase) DNA-3-methyladenine glycosylase EC 3.2.2.21 MDGalkyladenine DNA glycosylase Mid1 N-methylpurine-DNA glycosylase MPG N-methylpurine-DNA glycosylasePIG16 PIG11 proliferation-inducing protein 11 proliferation-inducing protein 16; 3' end of the Mid1 gene, localized 68 kb upstream the humanzeta globin gene on 16p; 3-alkyladenine DNA glycosylase; 3-methyladenine DNA glycosidase; ADPG; CRA36.1 (3-methyl-adenine DNA glycosylase); DNA-3-methyladenine glycosylase; N-methylpurine-DNA glycosylase; N-methylpurine-DNA glycosylase, MPG; proliferation-inducing protein 11; proliferation-inducing protein 16
Gene Aliases: AAG; ADPG; ANPG; APNG; CRA36.1; MDG; MID1; MPG; PIG11; PIG16
UniProt ID: (Human) P29372
Entrez Gene ID: (Human) 4350
Molecular Function:
DNA binding protein
DNA glycosylase
damaged DNA-binding protein
glycosidase
hydrolase
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.