Novus Biologicals
Manufacturer Code:NBP184570
Catalog # NBP184570
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDGIF FLJ14836 HBeAg-binding protein 2 binding protein A Lec35 mannose-P-dolichol utilization defect 1 mannose-P-dolichol utilization defect 1 protein My008 PP3958 PQLC5 SL15HBEBP2BPA Suppressor of Lec15 and Lec35 glycosylation mutation homolog; HBeAg-binding protein 2 binding protein A; Mannose-P-dolichol utilization defect 1 protein; SL15; Suppressor of Lec15 and Lec35 glycosylation mutation homolog
Gene Aliases: CDGIF; HBEBP2BPA; Lec35; MPDU1; My008; PP3958; PQLC5; SL15
UniProt ID: (Human) O75352
Entrez Gene ID: (Human) 9526
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.