Novus Biologicals
Manufacturer Code:NBP169519
Catalog # NBP169519
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MOSC1(MOCO sulphurase C-terminal domain containing 1) The peptide sequence was selected from the C terminal of MOSC1. Peptide sequence WDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ22390 MARC1 mitochondrial amidoxime reducing component 1 MOCO sulphurase C-terminal domain containing 1 MOSC domain-containing protein 1 mitochondrial; mARC1; Mitochondrial amidoxime-reducing component 1; moco sulfurase C-terminal domain-containing protein 1; MOCO sulphurase C-terminal domain containing 1; Molybdenum cofactor sulfurase C-terminal domain-containing protein 1; MOSC domain-containing protein 1; MOSC domain-containing protein 1, mitochondrial
Gene Aliases: MARC1; MOSC1; MTARC1
UniProt ID: (Human) Q5VT66
Entrez Gene ID: (Human) 64757
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.