Novus Biologicals
Manufacturer Code:NBP214245
Catalog # NBP214245
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2-acylglycerol O-acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1; Acyl-CoA:monoacylglycerol acyltransferase 1 DC2 DGAT2L Diacylglycerol acyltransferase 2-like protein 1 diacylglycerol O-acyltransferase 2 like 12-acylglycerol O-acyltransferase 1 Diacylglycerol O-acyltransferase candidate 2 EC 2.3.1 EC 2.3.1.22 MGAT1hDC2 monoacylglycerol O-acyltransferase 1DGAT2L1; Diacylglycerol acyltransferase 2-like protein 1; diacylglycerol O-acyltransferase 2 like 1; Diacylglycerol O-acyltransferase candidate 2; hDC2; MGAT1; Monoacylglycerol O-acyltransferase 1
Gene Aliases: DC2; DGAT2L; DGAT2L1; MGAT1; MOGAT1
UniProt ID: (Human) Q96PD6
Entrez Gene ID: (Human) 116255
Molecular Function:
acyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.