Novus Biologicals
Manufacturer Code:NBP214244
Catalog # NBP214244
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FQDEILRSSRQLVLPELGVHRHVLVVGCGGLRCPLAQYLAAASVGRLGLV DYDVVEMSNLAYQVLHGEALAAQAKAASAAASLRGLNLAVE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Adenylyltransferase and sulfurtransferase MOCS3; adenylyltransferase and sulfurtransferase MOCS3 dJ914P20.3 molybdenum cofactor synthesis 3 Molybdenum cofactor synthesis protein 3 Molybdopterin synthase sulfurylase MPT synthase sulfurylase UBA4 ubiquitin-activating enzyme E1 homolog UBA4MGC9252 ubiquitin-like modifier activating enzyme 4; Adenylyltransferase MOCS3; MOCS3; Molybdenum cofactor synthesis protein 3; Molybdopterin synthase sulfurylase; Molybdopterin-synthase adenylyltransferase; Molybdopterin-synthase sulfurtransferase; MPT synthase sulfurylase; Sulfur carrier protein MOCS2A adenylyltransferase; Sulfur carrier protein MOCS2A sulfurtransferase; Sulfurtransferase MOCS3; UBA4, ubiquitin-activating enzyme E1 homolog; ubiquitin-like modifier activating enzyme 4
Gene Aliases: MOCS3; UBA4
UniProt ID: (Human) O95396
Entrez Gene ID: (Human) 27304
Molecular Function:
ligase
transfer/carrier protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.