Novus Biologicals
Manufacturer Code:NBP238359
Catalog # NBP238359
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIRQKWPVKHIAVFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.- MCBPE MOCO1-A MOCO1-B MOCO1MOCS2B MOCS2A molybdenum cofactor biosynthesis protein E molybdenum cofactor synthesis 2 Molybdenum cofactor synthesis protein 2 large subunit Molybdenum cofactor synthesis protein 2 small subunit Molybdenum cofactor synthesis protein 2A Molybdenum cofactor synthesis protein 2B molybdopterin synthase catalytic subunit molybdopterin synthase sulfur carrier subunit Molybdopterin-synthase large subunit Molybdopterin-synthase small subunit MPT synthase large subunit MPTS Sulfur carrier protein MOCS2A; MOCO1-A; MOCO1-B; MOCS2A; MOCS2B; molybdenum cofactor biosynthesis protein E; Molybdenum cofactor synthesis protein 2 large subunit; Molybdenum cofactor synthesis protein 2 small subunit; Molybdenum cofactor synthesis protein 2A; Molybdenum cofactor synthesis protein 2B; Molybdopterin synthase catalytic subunit; molybdopterin synthase small and large subunit; Molybdopterin synthase sulfur carrier subunit; Molybdopterin-synthase large subunit; Molybdopterin-synthase small subunit; MPT synthase large subunit; Sulfur carrier protein MOCS2A
Gene Aliases: MCBPE; MOCO1; MOCODB; MOCS2; MPTS
UniProt ID: (Human) Q6IAI3
Entrez Gene ID: (Human) 4338
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.