Novus Biologicals
Manufacturer Code:NBP169201
Catalog # NBP169201
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MNS1 (meiosis-specific nuclear structural 1) The peptide sequence was selected from the N terminal of MNS1. Peptide sequence EKLAMELAKLKHESLKDEKMRQQVRENSIELRELEKKLKAAYMNKERAAQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ11222FLJ26051 meiosis-specific nuclear structural 1 meiosis-specific nuclear structural protein 1; meiosis-specific nuclear structural 1; Meiosis-specific nuclear structural protein 1; spermatogenesis associated 40
Gene Aliases: MNS1; SPATA40
UniProt ID: (Human) Q8NEH6
Entrez Gene ID: (Human) 55329
Molecular Function: structural protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.