Novus Biologicals
Manufacturer Code:NBP256054
Catalog # NBP256054
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.11 EC 2.7.11.1 MAP kinase interacting kinase 1 MAP kinase interacting serine/threonine kinase 1 MAP kinase signal-integrating kinase 1 MAP kinase-interacting serine/threonine-protein kinase 1 Mnk1 MNK1MAP kinase-interacting serine/threonine kinase 1; MAP kinase signal-integrating kinase 1; MAP kinase-interacting serine/threonine-protein kinase 1; MAPK signal-integrating kinase 1
Gene Aliases: MKNK1; MNK1
UniProt ID: (Human) Q9BUB5
Entrez Gene ID: (Human) 8569
Molecular Function:
cytoskeletal protein
kinase
microtubule family cytoskeletal protein
non-motor microtubule binding protein
non-receptor serine/threonine protein kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.