Novus Biologicals
Manufacturer Code:NBP15500120UL
Catalog # NBP1550020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MAP2K7(mitogen-activated protein kinase kinase 7) The peptide sequence was selected from the middle region of MAP2K7. Peptide sequence ERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: c-Jun N-terminal kinase kinase 2; c-Jun N-terminal kinase kinase 2 dual specificity mitogen-activated protein kinase kinase 7 EC 2.7.12.2 JNK kinase 2 JNK-activating kinase 2 JNKK 2 JNKK2 MAP kinase kinase 7 MAPK/ERK kinase 7 MAPKK7 MEK 7 MEK7 mitogen-activated protein kinase kinase 7 MKK7MAPKK 7 PRKMK7; Dual specificity mitogen-activated protein kinase kinase 7; JNK kinase 2; JNK-activating kinase 2; MAP kinase kinase 7; MAPK/ERK kinase 7; MEK 7; SAPK kinase 4; Stress-activated protein kinase kinase 4
Gene Aliases: JNKK2; MAP2K7; MAPKK7; MEK; MEK 7; MEK7; MKK7; PRKMK7; SAPKK-4; SAPKK4; SKK4
UniProt ID: (Human) O14733
Entrez Gene ID: (Human) 5609
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.