Novus Biologicals
Manufacturer Code:NBP257760
Catalog # NBP257760
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AKNGATGVELDIEFTSDGIPVLMHDNTVDRTTDGTGRLCDLTFEQIRKLNPAANHRLRNDFPDEKIPTLREAVAECLNHNLTIFFDVKGHAHKATEALKKMYMEFPQL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.1.4.44 glycerophosphodiester phosphodiesterase 1 membrane interacting protein of RGS16 Membrane-interacting protein of RGS16 MIR16363E6.2 RGS16-interacting membrane protein; Glycerophosphodiester phosphodiesterase 1; Glycerophosphoinositol glycerophosphodiesterase GDE1; Lysophospholipase D GDE1; membrane interacting protein of RGS16; Membrane-interacting protein of RGS16; RGS16-interacting membrane protein
Gene Aliases: 363E6.2; GDE1; MIR16
UniProt ID: (Human) Q9NZC3
Entrez Gene ID: (Human) 51573
Molecular Function:
esterase
hydrolase
ligase
phosphodiesterase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.