Novus Biologicals
Manufacturer Code:NBP231976
Catalog # NBP231976
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: aldehyde reductase (aldose reductase) like 6; aldehyde reductase (aldose reductase) like 6 Aldehyde reductase-like 6 ALDRL6 inositol oxygenase Kidney-specific protein 32 KSP32 MGC90217 MI oxygenase myo-inositol oxygenaseEC 1.13.99.1 Renal-specific oxidoreductase RSOR; Aldehyde reductase-like 6; Inositol oxygenase; Kidney-specific protein 32; MI oxygenase; Myo-inositol oxygenase; Renal-specific oxidoreductase
Gene Aliases: ALDRL6; KSP32; MIOX; RSOR
UniProt ID: (Human) Q9UGB7
Entrez Gene ID: (Human) 55586
Molecular Function:
oxidoreductase
oxygenase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.