Novus Biologicals
Manufacturer Code:NBP159185
Catalog # NBP159185
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to MICA(MHC class I polypeptide-related sequence A) The peptide sequence was selected from the middle region of MICA. Peptide sequence LRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ60820 MGC111087 PERB11.1; HLA class I antigen; MHC class I chain-related protein A; MHC class I polypeptide-related sequence A; MHC class I related sequence A; MIC-A; MICA; stress inducible class I homolog; truncated MHC class I polypeptide-related sequence A
Gene Aliases: MIC-A; MICA; PERB11.1
UniProt ID: (Human) Q29983
Entrez Gene ID: (Human) 100507436
Molecular Function:
cytokine receptor
defense/immunity protein
immunoglobulin receptor superfamily
major histocompatibility complex antigen
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.