Novus Biologicals
Manufacturer Code:NBP234160
Catalog # NBP234160
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LGMNENNIFEEAAVLDDIQDLIYFVRYKHSTAEETATLVMAPPLEEGLGGAMEEMQPLHEDNFSREKTAELNVQVPEEPTHLDQRVI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ARNT C219 Reactive Peptide C219-Reactive Peptide D320 KIAA0268 Melanoma Inhibitory Activity Family Member 3 Melanoma Inhibitory Activity Protein 3 TANGO TANGO1 Transport And Golgi Organization Transport And Golgi Organization Protein 1 UNQ6077; C219-reactive peptide; D320; melanoma inhibitory activity family member 3; melanoma inhibitory activity family, member 3; Melanoma inhibitory activity protein 3; TANGO1; transport and Golgi organization protein 1; Transport and Golgi organization protein 1 homolog
Gene Aliases: ARNT; D320; KIAA0268; MIA3; TANGO; TANGO1; UNQ6077; UNQ6077/PRO20088
UniProt ID: (Human) Q5JRA6
Entrez Gene ID: (Human) 375056
Molecular Function:
growth factor
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.