Novus Biologicals
Manufacturer Code:NBP179270
Catalog # NBP179270
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human C3orf31. Peptide sequence LPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLKKSVIYS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDP-DAG synthase; CDP-diacylglycerol synthase; chromosome 3 open reading frame 31 DKFZp434E0519 MGC16471 mitochondrial; Mitochondrial translocator assembly and maintenance protein 41 homolog; MMP37-like protein, mitochondrial; Phosphatidate cytidylyltransferase, mitochondrial; TAM41; TAM41, mitochondrial translocator assembly and maintenance protein, homolog
Gene Aliases: C3orf31; RAM41; TAM41; TAMM41
UniProt ID: (Human) Q96BW9
Entrez Gene ID: (Human) 132001
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.